PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast04G279200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family CO-like
Protein Properties Length: 361aa    MW: 37457.7 Da    PI: 6.3677
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast04G279200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.71.6e-051554440
            zf-B_box  4 rkCpeHee.kelqlfCedCqq.llCedClleeHkg..Htvv 40
                        r+C  ++   +++ +C++C   +lC+ C  + H +  H++v
  Brast04G279200.1.p 15 RRCGSCGGgSPATSHCRTCAGaFLCAGCDAA-HARagHERV 54
                        79*****7788********877*********.977889875 PP

2zf-B_box23.11.5e-075499342
            zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvpl 42
                         ++C+ +e  ++   C+ +   lC++C   +H g       H++vp+
  Brast04G279200.1.p 54 VWVCEVCELAPAAVACRADAAALCASCDADIH-GanplarrHERVPI 99
                        689*****************************.55899999*99997 PP

3CCT70.73.6e-24285328144
                 CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                         Rea+l+RY+eKrk+R+FeK+irY+sRKa+AesRpRvKGrF+k++
  Brast04G279200.1.p 285 REARLMRYREKRKNRRFEKTIRYASRKAYAESRPRVKGRFAKRT 328
                         9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.00241256IPR000315B-box-type zinc finger
PROSITE profilePS5011910.6655299IPR000315B-box-type zinc finger
PfamPF006431.6E-55399IPR000315B-box-type zinc finger
SMARTSM003368.9E-95799IPR000315B-box-type zinc finger
PROSITE profilePS5101716.986285327IPR010402CCT domain
PfamPF062034.4E-18285327IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MEMQGIGRYW GVGGRRCGSC GGGSPATSHC RTCAGAFLCA GCDAAHARAG HERVWVCEVC  60
ELAPAAVACR ADAAALCASC DADIHGANPL ARRHERVPIR PIGADPEHDD ADGHVSHDAL  120
PLLGEKLDAD DGVGVAGGGK EAMKLDSLFA DVMGEMDPFF GPELARFPHA DSVVPNGNNN  180
NNHGSGHGAL ELDFGAAASK PSSYSSYTAP SLGGSGSSSE VGLVPDAICG RGGGGIIELD  240
FSLSKAAYLP YSPTPTHTVS SAVDVAAVPE RDGAASTAAA GEVSREARLM RYREKRKNRR  300
FEKTIRYASR KAYAESRPRV KGRFAKRTED ADADADAAAT ARAPSCVLDF GSYYGVVPTF  360
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570553.11e-170PREDICTED: zinc finger protein CONSTANS-LIKE 5-like
TrEMBLI1HXW21e-170I1HXW2_BRADI; Uncharacterized protein
STRINGBRADI3G05800.11e-169(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.17e-23CONSTANS-like 5